Placeholder image of a protein
Icon representing a puzzle

1281: Revisiting Puzzle 70: Nucleosome Protein

Closed since over 9 years ago

Intermediate Overall Prediction

Summary

Created
September 06, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein domain is a component of the histone protein complex, which packages DNA into compact units called nucleosomes. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

Top groups

  1. Avatar for :) 11. :) 2 pts. 9,173
  2. Avatar for Natural Abilities 12. Natural Abilities 1 pt. 9,151
  3. Avatar for xkcd 13. xkcd 1 pt. 9,045
  4. Avatar for freefolder 14. freefolder 1 pt. 9,027
  5. Avatar for DSN @ Home 15. DSN @ Home 1 pt. 9,005
  6. Avatar for Deleted group 16. Deleted group pts. 8,049
  7. Avatar for Deleted group 17. Deleted group pts. 4,699
  8. Avatar for Window Group 18. Window Group 1 pt. 4,699
  1. Avatar for angeltrouble 141. angeltrouble Lv 1 1 pt. 8,871
  2. Avatar for xplocast1 142. xplocast1 Lv 1 1 pt. 8,858
  3. Avatar for Space Goat 143. Space Goat Lv 1 1 pt. 8,841
  4. Avatar for tom15366 144. tom15366 Lv 1 1 pt. 8,832
  5. Avatar for 5eelement 145. 5eelement Lv 1 1 pt. 8,816
  6. Avatar for Hansie 146. Hansie Lv 1 1 pt. 8,797
  7. Avatar for JackONeill12 147. JackONeill12 Lv 1 1 pt. 8,791
  8. Avatar for parsnip 148. parsnip Lv 1 1 pt. 8,773
  9. Avatar for jbmkfm125 149. jbmkfm125 Lv 1 1 pt. 8,772
  10. Avatar for roflplatypus 150. roflplatypus Lv 1 1 pt. 8,762

Comments