Placeholder image of a protein
Icon representing a puzzle

1281: Revisiting Puzzle 70: Nucleosome Protein

Closed since over 9 years ago

Intermediate Overall Prediction

Summary

Created
September 06, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein domain is a component of the histone protein complex, which packages DNA into compact units called nucleosomes. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 9,562
  2. Avatar for Beta Folders 2. Beta Folders 74 pts. 9,524
  3. Avatar for Go Science 3. Go Science 54 pts. 9,504
  4. Avatar for Contenders 4. Contenders 38 pts. 9,499
  5. Avatar for Void Crushers 5. Void Crushers 27 pts. 9,424
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 18 pts. 9,404
  7. Avatar for Gargleblasters 7. Gargleblasters 12 pts. 9,404
  8. Avatar for HMT heritage 8. HMT heritage 8 pts. 9,392
  9. Avatar for Italiani Al Lavoro 9. Italiani Al Lavoro 5 pts. 9,334
  10. Avatar for It's over 9000! 10. It's over 9000! 3 pts. 9,245
  1. Avatar for angeltrouble 141. angeltrouble Lv 1 1 pt. 8,871
  2. Avatar for xplocast1 142. xplocast1 Lv 1 1 pt. 8,858
  3. Avatar for Space Goat 143. Space Goat Lv 1 1 pt. 8,841
  4. Avatar for tom15366 144. tom15366 Lv 1 1 pt. 8,832
  5. Avatar for 5eelement 145. 5eelement Lv 1 1 pt. 8,816
  6. Avatar for Hansie 146. Hansie Lv 1 1 pt. 8,797
  7. Avatar for JackONeill12 147. JackONeill12 Lv 1 1 pt. 8,791
  8. Avatar for parsnip 148. parsnip Lv 1 1 pt. 8,773
  9. Avatar for jbmkfm125 149. jbmkfm125 Lv 1 1 pt. 8,772
  10. Avatar for roflplatypus 150. roflplatypus Lv 1 1 pt. 8,762

Comments