Placeholder image of a protein
Icon representing a puzzle

1281: Revisiting Puzzle 70: Nucleosome Protein

Closed since over 9 years ago

Intermediate Overall Prediction

Summary

Created
September 06, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein domain is a component of the histone protein complex, which packages DNA into compact units called nucleosomes. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

Top groups

  1. Avatar for :) 11. :) 2 pts. 9,173
  2. Avatar for Natural Abilities 12. Natural Abilities 1 pt. 9,151
  3. Avatar for xkcd 13. xkcd 1 pt. 9,045
  4. Avatar for freefolder 14. freefolder 1 pt. 9,027
  5. Avatar for DSN @ Home 15. DSN @ Home 1 pt. 9,005
  6. Avatar for Deleted group 16. Deleted group pts. 8,049
  7. Avatar for Deleted group 17. Deleted group pts. 4,699
  8. Avatar for Window Group 18. Window Group 1 pt. 4,699
  1. Avatar for yazzie195 161. yazzie195 Lv 1 1 pt. 8,668
  2. Avatar for ivalnic 162. ivalnic Lv 1 1 pt. 8,665
  3. Avatar for Karsten69 163. Karsten69 Lv 1 1 pt. 8,658
  4. Avatar for NotJim99 164. NotJim99 Lv 1 1 pt. 8,635
  5. Avatar for JamesG520 165. JamesG520 Lv 1 1 pt. 8,633
  6. Avatar for tweak64 166. tweak64 Lv 1 1 pt. 8,602
  7. Avatar for Phosphoros042 167. Phosphoros042 Lv 1 1 pt. 8,598
  8. Avatar for fluffykitty 168. fluffykitty Lv 1 1 pt. 8,598
  9. Avatar for deathbat_87 169. deathbat_87 Lv 1 1 pt. 8,574
  10. Avatar for multaq 170. multaq Lv 1 1 pt. 8,551

Comments