Placeholder image of a protein
Icon representing a puzzle

1281: Revisiting Puzzle 70: Nucleosome Protein

Closed since over 9 years ago

Intermediate Overall Prediction

Summary

Created
September 06, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein domain is a component of the histone protein complex, which packages DNA into compact units called nucleosomes. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 9,562
  2. Avatar for Beta Folders 2. Beta Folders 74 pts. 9,524
  3. Avatar for Go Science 3. Go Science 54 pts. 9,504
  4. Avatar for Contenders 4. Contenders 38 pts. 9,499
  5. Avatar for Void Crushers 5. Void Crushers 27 pts. 9,424
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 18 pts. 9,404
  7. Avatar for Gargleblasters 7. Gargleblasters 12 pts. 9,404
  8. Avatar for HMT heritage 8. HMT heritage 8 pts. 9,392
  9. Avatar for Italiani Al Lavoro 9. Italiani Al Lavoro 5 pts. 9,334
  10. Avatar for It's over 9000! 10. It's over 9000! 3 pts. 9,245
  1. Avatar for yazzie195 161. yazzie195 Lv 1 1 pt. 8,668
  2. Avatar for ivalnic 162. ivalnic Lv 1 1 pt. 8,665
  3. Avatar for Karsten69 163. Karsten69 Lv 1 1 pt. 8,658
  4. Avatar for NotJim99 164. NotJim99 Lv 1 1 pt. 8,635
  5. Avatar for JamesG520 165. JamesG520 Lv 1 1 pt. 8,633
  6. Avatar for tweak64 166. tweak64 Lv 1 1 pt. 8,602
  7. Avatar for Phosphoros042 167. Phosphoros042 Lv 1 1 pt. 8,598
  8. Avatar for fluffykitty 168. fluffykitty Lv 1 1 pt. 8,598
  9. Avatar for deathbat_87 169. deathbat_87 Lv 1 1 pt. 8,574
  10. Avatar for multaq 170. multaq Lv 1 1 pt. 8,551

Comments