Placeholder image of a protein
Icon representing a puzzle

1281: Revisiting Puzzle 70: Nucleosome Protein

Closed since over 9 years ago

Intermediate Overall Prediction

Summary

Created
September 06, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein domain is a component of the histone protein complex, which packages DNA into compact units called nucleosomes. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

Top groups

  1. Avatar for :) 11. :) 2 pts. 9,173
  2. Avatar for Natural Abilities 12. Natural Abilities 1 pt. 9,151
  3. Avatar for xkcd 13. xkcd 1 pt. 9,045
  4. Avatar for freefolder 14. freefolder 1 pt. 9,027
  5. Avatar for DSN @ Home 15. DSN @ Home 1 pt. 9,005
  6. Avatar for Deleted group 16. Deleted group pts. 8,049
  7. Avatar for Deleted group 17. Deleted group pts. 4,699
  8. Avatar for Window Group 18. Window Group 1 pt. 4,699
  1. Avatar for sor2018 171. sor2018 Lv 1 1 pt. 8,527
  2. Avatar for anonycat 172. anonycat Lv 1 1 pt. 8,522
  3. Avatar for sean4046 173. sean4046 Lv 1 1 pt. 8,519
  4. Avatar for rblue1996 174. rblue1996 Lv 1 1 pt. 8,513
  5. Avatar for cole.travis 175. cole.travis Lv 1 1 pt. 8,498
  6. Avatar for emtonsti 176. emtonsti Lv 1 1 pt. 8,495
  7. Avatar for miloszek07 177. miloszek07 Lv 1 1 pt. 8,490
  8. Avatar for David_Steele 178. David_Steele Lv 1 1 pt. 8,489
  9. Avatar for RoboKay314 179. RoboKay314 Lv 1 1 pt. 8,460
  10. Avatar for sa_simsalabim 180. sa_simsalabim Lv 1 1 pt. 8,437

Comments