Placeholder image of a protein
Icon representing a puzzle

1281: Revisiting Puzzle 70: Nucleosome Protein

Closed since over 9 years ago

Intermediate Overall Prediction

Summary

Created
September 06, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein domain is a component of the histone protein complex, which packages DNA into compact units called nucleosomes. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 9,562
  2. Avatar for Beta Folders 2. Beta Folders 74 pts. 9,524
  3. Avatar for Go Science 3. Go Science 54 pts. 9,504
  4. Avatar for Contenders 4. Contenders 38 pts. 9,499
  5. Avatar for Void Crushers 5. Void Crushers 27 pts. 9,424
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 18 pts. 9,404
  7. Avatar for Gargleblasters 7. Gargleblasters 12 pts. 9,404
  8. Avatar for HMT heritage 8. HMT heritage 8 pts. 9,392
  9. Avatar for Italiani Al Lavoro 9. Italiani Al Lavoro 5 pts. 9,334
  10. Avatar for It's over 9000! 10. It's over 9000! 3 pts. 9,245
  1. Avatar for sor2018 171. sor2018 Lv 1 1 pt. 8,527
  2. Avatar for anonycat 172. anonycat Lv 1 1 pt. 8,522
  3. Avatar for sean4046 173. sean4046 Lv 1 1 pt. 8,519
  4. Avatar for rblue1996 174. rblue1996 Lv 1 1 pt. 8,513
  5. Avatar for cole.travis 175. cole.travis Lv 1 1 pt. 8,498
  6. Avatar for emtonsti 176. emtonsti Lv 1 1 pt. 8,495
  7. Avatar for miloszek07 177. miloszek07 Lv 1 1 pt. 8,490
  8. Avatar for David_Steele 178. David_Steele Lv 1 1 pt. 8,489
  9. Avatar for RoboKay314 179. RoboKay314 Lv 1 1 pt. 8,460
  10. Avatar for sa_simsalabim 180. sa_simsalabim Lv 1 1 pt. 8,437

Comments