Placeholder image of a protein
Icon representing a puzzle

1281: Revisiting Puzzle 70: Nucleosome Protein

Closed since over 9 years ago

Intermediate Overall Prediction

Summary


Created
September 06, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein domain is a component of the histone protein complex, which packages DNA into compact units called nucleosomes. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

Top groups


  1. Avatar for :) 11. :) 2 pts. 9,173
  2. Avatar for Natural Abilities 12. Natural Abilities 1 pt. 9,151
  3. Avatar for xkcd 13. xkcd 1 pt. 9,045
  4. Avatar for freefolder 14. freefolder 1 pt. 9,027
  5. Avatar for DSN @ Home 15. DSN @ Home 1 pt. 9,005
  6. Avatar for Deleted group 16. Deleted group pts. 8,049
  7. Avatar for Deleted group 17. Deleted group pts. 4,699
  8. Avatar for Window Group 18. Window Group 1 pt. 4,699

  1. Avatar for Deleted player 191. Deleted player pts. 4,699
  2. Avatar for immortal_eternity 192. immortal_eternity Lv 1 1 pt. 4,699
  3. Avatar for Heather Horne 193. Heather Horne Lv 1 1 pt. 4,699
  4. Avatar for smholst 194. smholst Lv 1 1 pt. 4,699
  5. Avatar for jflat06 195. jflat06 Lv 1 1 pt. 4,699
  6. Avatar for gdnskye 197. gdnskye Lv 1 1 pt. 4,699
  7. Avatar for Aquanimation 199. Aquanimation Lv 1 1 pt. 4,699
  8. Avatar for robkleffner 200. robkleffner Lv 1 1 pt. 4,699

Comments