Placeholder image of a protein
Icon representing a puzzle

1281: Revisiting Puzzle 70: Nucleosome Protein

Closed since over 9 years ago

Intermediate Overall Prediction

Summary


Created
September 06, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein domain is a component of the histone protein complex, which packages DNA into compact units called nucleosomes. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 9,562
  2. Avatar for Beta Folders 2. Beta Folders 74 pts. 9,524
  3. Avatar for Go Science 3. Go Science 54 pts. 9,504
  4. Avatar for Contenders 4. Contenders 38 pts. 9,499
  5. Avatar for Void Crushers 5. Void Crushers 27 pts. 9,424
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 18 pts. 9,404
  7. Avatar for Gargleblasters 7. Gargleblasters 12 pts. 9,404
  8. Avatar for HMT heritage 8. HMT heritage 8 pts. 9,392
  9. Avatar for Italiani Al Lavoro 9. Italiani Al Lavoro 5 pts. 9,334
  10. Avatar for It's over 9000! 10. It's over 9000! 3 pts. 9,245

  1. Avatar for Deleted player 191. Deleted player pts. 4,699
  2. Avatar for immortal_eternity 192. immortal_eternity Lv 1 1 pt. 4,699
  3. Avatar for Heather Horne 193. Heather Horne Lv 1 1 pt. 4,699
  4. Avatar for smholst 194. smholst Lv 1 1 pt. 4,699
  5. Avatar for jflat06 195. jflat06 Lv 1 1 pt. 4,699
  6. Avatar for gdnskye 197. gdnskye Lv 1 1 pt. 4,699
  7. Avatar for Aquanimation 199. Aquanimation Lv 1 1 pt. 4,699
  8. Avatar for robkleffner 200. robkleffner Lv 1 1 pt. 4,699

Comments