1281: Revisiting Puzzle 70: Nucleosome Protein
Closed since over 9 years ago
Intermediate Overall PredictionSummary
- Created
- September 06, 2016
- Expires
- Max points
- 100
This is a throwback puzzle to the early days of Foldit. This protein domain is a component of the histone protein complex, which packages DNA into compact units called nucleosomes. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.
Sequence:
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Top groups
-
100 pts. 9,562
-
-
-
-
-
-
-
-
-