Placeholder image of a protein
Icon representing a puzzle

1281: Revisiting Puzzle 70: Nucleosome Protein

Closed since over 9 years ago

Intermediate Overall Prediction

Summary

Created
September 06, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein domain is a component of the histone protein complex, which packages DNA into compact units called nucleosomes. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 9,562
  2. Avatar for Beta Folders 2. Beta Folders 74 pts. 9,524
  3. Avatar for Go Science 3. Go Science 54 pts. 9,504
  4. Avatar for Contenders 4. Contenders 38 pts. 9,499
  5. Avatar for Void Crushers 5. Void Crushers 27 pts. 9,424
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 18 pts. 9,404
  7. Avatar for Gargleblasters 7. Gargleblasters 12 pts. 9,404
  8. Avatar for HMT heritage 8. HMT heritage 8 pts. 9,392
  9. Avatar for Italiani Al Lavoro 9. Italiani Al Lavoro 5 pts. 9,334
  10. Avatar for It's over 9000! 10. It's over 9000! 3 pts. 9,245
  1. Avatar for randomlil 41. randomlil Lv 1 33 pts. 9,340
  2. Avatar for Crossed Sticks 42. Crossed Sticks Lv 1 32 pts. 9,336
  3. Avatar for jobo0502 43. jobo0502 Lv 1 31 pts. 9,335
  4. Avatar for pmthomson90 44. pmthomson90 Lv 1 30 pts. 9,334
  5. Avatar for YeshuaLives 45. YeshuaLives Lv 1 29 pts. 9,333
  6. Avatar for dssb 46. dssb Lv 1 28 pts. 9,322
  7. Avatar for Anfinsen_slept_here 47. Anfinsen_slept_here Lv 1 27 pts. 9,321
  8. Avatar for WBarme1234 48. WBarme1234 Lv 1 26 pts. 9,320
  9. Avatar for Simek 49. Simek Lv 1 26 pts. 9,316
  10. Avatar for Jesse Pinkman 50. Jesse Pinkman Lv 1 25 pts. 9,315

Comments