Placeholder image of a protein
Icon representing a puzzle

1283: Unsolved De-novo Freestyle 86

Closed since over 9 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary

Created
September 09, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


RLDELEELKKELEKDRERWEKQTTSSHLEELKKELEKLKKELEKMKGDQTEHRFRTRYRTDTSEYEVEIEITDGQTRMRSREHSR

Top groups

  1. Avatar for freefolder 11. freefolder 1 pt. 8,745
  2. Avatar for :) 12. :) 1 pt. 8,608
  3. Avatar for NanobotsUU2016 13. NanobotsUU2016 1 pt. 6,473
  4. Avatar for CureCoin 14. CureCoin 1 pt. 6,445
  5. Avatar for Biology 2 15. Biology 2 1 pt. 5,965
  6. Avatar for Deleted group 16. Deleted group pts. 5,955
  7. Avatar for DSN @ Home 17. DSN @ Home 1 pt. 5,746
  1. Avatar for Merf 51. Merf Lv 1 23 pts. 9,209
  2. Avatar for smilingone 52. smilingone Lv 1 22 pts. 9,209
  3. Avatar for hpaege 53. hpaege Lv 1 21 pts. 9,204
  4. Avatar for bendbob 54. bendbob Lv 1 21 pts. 9,185
  5. Avatar for bx7gn 55. bx7gn Lv 1 20 pts. 9,164
  6. Avatar for Deleted player 56. Deleted player pts. 9,132
  7. Avatar for manu8170 57. manu8170 Lv 1 19 pts. 9,117
  8. Avatar for pfirth 58. pfirth Lv 1 18 pts. 9,116
  9. Avatar for crpainter 59. crpainter Lv 1 17 pts. 9,088
  10. Avatar for guineapig 60. guineapig Lv 1 17 pts. 9,081

Comments