Placeholder image of a protein
Icon representing a puzzle

1283: Unsolved De-novo Freestyle 86

Closed since over 9 years ago

Intermediate Overall Prediction

Summary

Created
September 09, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


RLDELEELKKELEKDRERWEKQTTSSHLEELKKELEKLKKELEKMKGDQTEHRFRTRYRTDTSEYEVEIEITDGQTRMRSREHSR

Top groups

  1. Avatar for Gargleblasters
    1. Gargleblasters
    100 pts. 9,731
  2. Avatar for Beta Folders 2. Beta Folders 73 pts. 9,716
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 52 pts. 9,682
  4. Avatar for Contenders 4. Contenders 36 pts. 9,640
  5. Avatar for Void Crushers 5. Void Crushers 24 pts. 9,550
  6. Avatar for Go Science 6. Go Science 16 pts. 9,464
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 10 pts. 9,460
  8. Avatar for Deleted group 8. Deleted group pts. 9,304
  9. Avatar for HMT heritage 9. HMT heritage 4 pts. 9,298
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 2 pts. 8,806
  1. Avatar for Merf 51. Merf Lv 1 23 pts. 9,209
  2. Avatar for smilingone 52. smilingone Lv 1 22 pts. 9,209
  3. Avatar for hpaege 53. hpaege Lv 1 21 pts. 9,204
  4. Avatar for bendbob 54. bendbob Lv 1 21 pts. 9,185
  5. Avatar for bx7gn 55. bx7gn Lv 1 20 pts. 9,164
  6. Avatar for Deleted player 56. Deleted player pts. 9,132
  7. Avatar for manu8170 57. manu8170 Lv 1 19 pts. 9,117
  8. Avatar for pfirth 58. pfirth Lv 1 18 pts. 9,116
  9. Avatar for crpainter 59. crpainter Lv 1 17 pts. 9,088
  10. Avatar for guineapig 60. guineapig Lv 1 17 pts. 9,081

Comments