Placeholder image of a protein
Icon representing a puzzle

1292: Revisiting Puzzle 73: Polycystein

Closed since over 9 years ago

Intermediate Overall Prediction

Summary


Created
October 05, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of a large glycoprotein in humans that has been linked to autosomal dominant polycystic kidney disease. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ATLVGPHGPLASGQLAAFHIAAPLPVTATRWDFGDGSAEVDAAGPAASHRYVLPGRYHVTAVLALGAGSALLGTDVQVEA

Top groups


  1. Avatar for Window Group 21. Window Group 1 pt. 6,614

  1. Avatar for Bruno Kestemont 21. Bruno Kestemont Lv 1 63 pts. 9,211
  2. Avatar for Deleted player 22. Deleted player 61 pts. 9,199
  3. Avatar for jobo0502 23. jobo0502 Lv 1 60 pts. 9,185
  4. Avatar for Deleted player 24. Deleted player pts. 9,177
  5. Avatar for Museka 25. Museka Lv 1 57 pts. 9,175
  6. Avatar for caglar 26. caglar Lv 1 56 pts. 9,170
  7. Avatar for WBarme1234 27. WBarme1234 Lv 1 54 pts. 9,165
  8. Avatar for tokens 28. tokens Lv 1 53 pts. 9,160
  9. Avatar for gmn 29. gmn Lv 1 52 pts. 9,157
  10. Avatar for YeshuaLives 30. YeshuaLives Lv 1 50 pts. 9,144

Comments