Placeholder image of a protein
Icon representing a puzzle

1292: Revisiting Puzzle 73: Polycystein

Closed since over 9 years ago

Intermediate Overall Prediction

Summary


Created
October 05, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of a large glycoprotein in humans that has been linked to autosomal dominant polycystic kidney disease. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ATLVGPHGPLASGQLAAFHIAAPLPVTATRWDFGDGSAEVDAAGPAASHRYVLPGRYHVTAVLALGAGSALLGTDVQVEA

Top groups


  1. Avatar for Window Group 21. Window Group 1 pt. 6,614

  1. Avatar for deLaCeiba 71. deLaCeiba Lv 1 16 pts. 8,925
  2. Avatar for ComputerMage 72. ComputerMage Lv 1 15 pts. 8,921
  3. Avatar for SKSbell 73. SKSbell Lv 1 15 pts. 8,920
  4. Avatar for dssb 74. dssb Lv 1 14 pts. 8,897
  5. Avatar for hansvandenhof 75. hansvandenhof Lv 1 14 pts. 8,890
  6. Avatar for Merf 76. Merf Lv 1 13 pts. 8,888
  7. Avatar for demeter900 77. demeter900 Lv 1 13 pts. 8,882
  8. Avatar for Psych0Active 78. Psych0Active Lv 1 13 pts. 8,880
  9. Avatar for Geyalust 79. Geyalust Lv 1 12 pts. 8,880
  10. Avatar for bx7gn 80. bx7gn Lv 1 12 pts. 8,870

Comments