Placeholder image of a protein
Icon representing a puzzle

1295: Revisiting Puzzle 74: Platypus Venom

Closed since over 9 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
October 12, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small peptide was discovered in platypus venom—a rare instance of mammalian-produced venom, although this peptide appears similar to more widespread antimicrobials. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


FVQHRPRDCESINGVCRHKDTVNCREIFLADCYNDGQKCCRK

Top groups


  1. Avatar for Beta Folders 100 pts. 9,245
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 78 pts. 9,244
  3. Avatar for Contenders 3. Contenders 60 pts. 9,239
  4. Avatar for Gargleblasters 4. Gargleblasters 45 pts. 9,233
  5. Avatar for Go Science 5. Go Science 33 pts. 9,224
  6. Avatar for Void Crushers 6. Void Crushers 24 pts. 9,177
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 17 pts. 9,175
  8. Avatar for HMT heritage 8. HMT heritage 12 pts. 9,165
  9. Avatar for Russian team 9. Russian team 8 pts. 9,120
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 6 pts. 9,028

  1. Avatar for Vredeman 21. Vredeman Lv 1 62 pts. 9,170
  2. Avatar for Deleted player 22. Deleted player pts. 9,166
  3. Avatar for pmdpmd 23. pmdpmd Lv 1 59 pts. 9,166
  4. Avatar for gmn 24. gmn Lv 1 57 pts. 9,165
  5. Avatar for O Seki To 25. O Seki To Lv 1 56 pts. 9,165
  6. Avatar for reefyrob 26. reefyrob Lv 1 54 pts. 9,164
  7. Avatar for phi16 27. phi16 Lv 1 53 pts. 9,157
  8. Avatar for actiasluna 28. actiasluna Lv 1 52 pts. 9,157
  9. Avatar for ZeroLeak7 29. ZeroLeak7 Lv 1 50 pts. 9,153
  10. Avatar for Galaxie 30. Galaxie Lv 1 49 pts. 9,152

Comments