Placeholder image of a protein
Icon representing a puzzle

1295: Revisiting Puzzle 74: Platypus Venom

Closed since over 9 years ago

Intermediate Overall Prediction

Summary

Created
October 12, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small peptide was discovered in platypus venom—a rare instance of mammalian-produced venom, although this peptide appears similar to more widespread antimicrobials. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


FVQHRPRDCESINGVCRHKDTVNCREIFLADCYNDGQKCCRK

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 9,245
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 78 pts. 9,244
  3. Avatar for Contenders 3. Contenders 60 pts. 9,239
  4. Avatar for Gargleblasters 4. Gargleblasters 45 pts. 9,233
  5. Avatar for Go Science 5. Go Science 33 pts. 9,224
  6. Avatar for Void Crushers 6. Void Crushers 24 pts. 9,177
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 17 pts. 9,175
  8. Avatar for HMT heritage 8. HMT heritage 12 pts. 9,165
  9. Avatar for Russian team 9. Russian team 8 pts. 9,120
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 6 pts. 9,028
  1. Avatar for severin333 91. severin333 Lv 1 7 pts. 8,785
  2. Avatar for BCAA 92. BCAA Lv 1 7 pts. 8,758
  3. Avatar for Formula350 93. Formula350 Lv 1 7 pts. 8,739
  4. Avatar for SKSbell 94. SKSbell Lv 1 6 pts. 8,736
  5. Avatar for alrianne 95. alrianne Lv 1 6 pts. 8,693
  6. Avatar for carsonfb 96. carsonfb Lv 1 6 pts. 8,678
  7. Avatar for cynwulf28 97. cynwulf28 Lv 1 6 pts. 8,598
  8. Avatar for altejoh 98. altejoh Lv 1 5 pts. 8,564
  9. Avatar for ManVsYard 99. ManVsYard Lv 1 5 pts. 8,563
  10. Avatar for Geyalust 100. Geyalust Lv 1 5 pts. 8,507

Comments