Placeholder image of a protein
Icon representing a puzzle

1295: Revisiting Puzzle 74: Platypus Venom

Closed since over 9 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
October 12, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small peptide was discovered in platypus venom—a rare instance of mammalian-produced venom, although this peptide appears similar to more widespread antimicrobials. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


FVQHRPRDCESINGVCRHKDTVNCREIFLADCYNDGQKCCRK

Top groups


  1. Avatar for Beta Folders 100 pts. 9,245
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 78 pts. 9,244
  3. Avatar for Contenders 3. Contenders 60 pts. 9,239
  4. Avatar for Gargleblasters 4. Gargleblasters 45 pts. 9,233
  5. Avatar for Go Science 5. Go Science 33 pts. 9,224
  6. Avatar for Void Crushers 6. Void Crushers 24 pts. 9,177
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 17 pts. 9,175
  8. Avatar for HMT heritage 8. HMT heritage 12 pts. 9,165
  9. Avatar for Russian team 9. Russian team 8 pts. 9,120
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 6 pts. 9,028

  1. Avatar for manu8170 51. manu8170 Lv 1 27 pts. 9,046
  2. Avatar for hansvandenhof 52. hansvandenhof Lv 1 26 pts. 9,045
  3. Avatar for Anfinsen_slept_here 53. Anfinsen_slept_here Lv 1 26 pts. 9,040
  4. Avatar for caglar 54. caglar Lv 1 25 pts. 9,035
  5. Avatar for YeshuaLives 55. YeshuaLives Lv 1 24 pts. 9,034
  6. Avatar for Crossed Sticks 56. Crossed Sticks Lv 1 23 pts. 9,031
  7. Avatar for Restartbob 57. Restartbob Lv 1 23 pts. 9,029
  8. Avatar for Bushman 58. Bushman Lv 1 22 pts. 9,028
  9. Avatar for saksoft2 59. saksoft2 Lv 1 21 pts. 9,025
  10. Avatar for pvc78 60. pvc78 Lv 1 21 pts. 9,024

Comments