Placeholder image of a protein
Icon representing a puzzle

1300: Revisiting Puzzle 75 with Density: Antifreeze Protein

Closed since over 9 years ago

Intermediate Overall Prediction Electron Density

Summary

Created
October 25, 2016
Expires
Max points
100
Description

This is a repost of Puzzle 1298, now with an electron density map! This eelpout protein binds nucleated ice crystals to inhibit their growth. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been. Players may load in solutions from Puzzle 1298.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNRAVPLGTTLMPDMVRGYAA

Top groups

  1. Avatar for Eὕρηκα! Heureka! 11. Eὕρηκα! Heureka! 5 pts. 12,343
  2. Avatar for freefolder 12. freefolder 4 pts. 12,163
  3. Avatar for DSN @ Home 13. DSN @ Home 2 pts. 12,059
  4. Avatar for xkcd 14. xkcd 2 pts. 11,314
  5. Avatar for HMT heritage 15. HMT heritage 1 pt. 9,468
  6. Avatar for Storm 16. Storm 1 pt. 8,981
  7. Avatar for It's over 9000! 17. It's over 9000! 1 pt. 8,811
  8. Avatar for INFINITAS 18. INFINITAS 1 pt. 8,810
  9. Avatar for SETI.Germany 19. SETI.Germany 1 pt. 8,598
  10. Avatar for Biochem-AD17 20. Biochem-AD17 1 pt. 8,569
  1. Avatar for Thebatman012 141. Thebatman012 Lv 1 1 pt. 8,642
  2. Avatar for aendgraend 142. aendgraend Lv 1 1 pt. 8,598
  3. Avatar for A01630489 143. A01630489 Lv 1 1 pt. 8,569
  4. Avatar for lamoille 144. lamoille Lv 1 1 pt. 8,560
  5. Avatar for turbolag 145. turbolag Lv 1 1 pt. 8,559
  6. Avatar for ivalnic 146. ivalnic Lv 1 1 pt. 8,526
  7. Avatar for krisha_lim 147. krisha_lim Lv 1 1 pt. 8,523
  8. Avatar for Kujonj32 148. Kujonj32 Lv 1 1 pt. 8,490
  9. Avatar for phi16 149. phi16 Lv 1 1 pt. 8,455
  10. Avatar for Cerzax 150. Cerzax Lv 1 1 pt. 8,431

Comments