Placeholder image of a protein
Icon representing a puzzle

1300: Revisiting Puzzle 75 with Density: Antifreeze Protein

Closed since over 9 years ago

Intermediate Overall Prediction Electron Density

Summary

Created
October 25, 2016
Expires
Max points
100
Description

This is a repost of Puzzle 1298, now with an electron density map! This eelpout protein binds nucleated ice crystals to inhibit their growth. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been. Players may load in solutions from Puzzle 1298.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNRAVPLGTTLMPDMVRGYAA

Top groups

  1. Avatar for Eὕρηκα! Heureka! 11. Eὕρηκα! Heureka! 5 pts. 12,343
  2. Avatar for freefolder 12. freefolder 4 pts. 12,163
  3. Avatar for DSN @ Home 13. DSN @ Home 2 pts. 12,059
  4. Avatar for xkcd 14. xkcd 2 pts. 11,314
  5. Avatar for HMT heritage 15. HMT heritage 1 pt. 9,468
  6. Avatar for Storm 16. Storm 1 pt. 8,981
  7. Avatar for It's over 9000! 17. It's over 9000! 1 pt. 8,811
  8. Avatar for INFINITAS 18. INFINITAS 1 pt. 8,810
  9. Avatar for SETI.Germany 19. SETI.Germany 1 pt. 8,598
  10. Avatar for Biochem-AD17 20. Biochem-AD17 1 pt. 8,569
  1. Avatar for gitwut 11. gitwut Lv 1 76 pts. 12,700
  2. Avatar for johnmitch 12. johnmitch Lv 1 74 pts. 12,700
  3. Avatar for Susume 13. Susume Lv 1 72 pts. 12,700
  4. Avatar for Mike Lewis 14. Mike Lewis Lv 1 70 pts. 12,699
  5. Avatar for Deleted player 15. Deleted player pts. 12,698
  6. Avatar for grogar7 16. grogar7 Lv 1 66 pts. 12,696
  7. Avatar for dcrwheeler 17. dcrwheeler Lv 1 64 pts. 12,696
  8. Avatar for Bletchley Park 18. Bletchley Park Lv 1 62 pts. 12,695
  9. Avatar for christioanchauvin 19. christioanchauvin Lv 1 60 pts. 12,695
  10. Avatar for nicobul 20. nicobul Lv 1 58 pts. 12,695

Comments