Placeholder image of a protein
Icon representing a puzzle

1307: Unsolved De-novo Freestyle 90

Closed since over 9 years ago

Intermediate Overall Prediction

Summary

Created
November 11, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


QEKMERIRQRFEEDLKKDNNMEVHIHLHNNKIELRIRIGNEESRVEVRINGDELDIQVRNSGKTIEELIQRWKEEIKKIV

Top groups

  1. Avatar for Eὕρηκα! Heureka! 11. Eὕρηκα! Heureka! 1 pt. 7,783
  2. Avatar for BiboKids 12. BiboKids 1 pt. 7,413
  3. Avatar for Freeport Honors Biology 13. Freeport Honors Biology 1 pt. 7,124
  4. Avatar for Deleted group 14. Deleted group pts. 6,871
  5. Avatar for AST Biology 15. AST Biology 1 pt. 6,281
  6. Avatar for Russian team 16. Russian team 1 pt. 5,907
  7. Avatar for DSN @ Home 17. DSN @ Home 1 pt. 5,465
  1. Avatar for Geyalust 91. Geyalust Lv 1 4 pts. 8,511
  2. Avatar for JayD7217 92. JayD7217 Lv 1 4 pts. 8,479
  3. Avatar for haabermaaster 93. haabermaaster Lv 1 4 pts. 8,464
  4. Avatar for SKSbell 94. SKSbell Lv 1 3 pts. 8,432
  5. Avatar for Alistair69 95. Alistair69 Lv 1 3 pts. 8,392
  6. Avatar for marsfan 96. marsfan Lv 1 3 pts. 8,379
  7. Avatar for cynwulf28 97. cynwulf28 Lv 1 3 pts. 8,368
  8. Avatar for karost 98. karost Lv 1 3 pts. 8,359
  9. Avatar for Jim Fraser 99. Jim Fraser Lv 1 3 pts. 8,354
  10. Avatar for parsnip 100. parsnip Lv 1 3 pts. 8,339

Comments