Placeholder image of a protein
Icon representing a puzzle

1307: Unsolved De-novo Freestyle 90

Closed since over 9 years ago

Intermediate Overall Prediction

Summary

Created
November 11, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


QEKMERIRQRFEEDLKKDNNMEVHIHLHNNKIELRIRIGNEESRVEVRINGDELDIQVRNSGKTIEELIQRWKEEIKKIV

Top groups

  1. Avatar for Contenders
    1. Contenders
    100 pts. 9,530
  2. Avatar for Go Science 2. Go Science 73 pts. 9,517
  3. Avatar for Gargleblasters 3. Gargleblasters 52 pts. 9,495
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 36 pts. 9,494
  5. Avatar for Beta Folders 5. Beta Folders 24 pts. 9,468
  6. Avatar for Void Crushers 6. Void Crushers 16 pts. 9,453
  7. Avatar for Deleted group 7. Deleted group pts. 9,448
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 6 pts. 9,396
  9. Avatar for xkcd 9. xkcd 4 pts. 9,287
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 2 pts. 8,464
  1. Avatar for Geyalust 91. Geyalust Lv 1 4 pts. 8,511
  2. Avatar for JayD7217 92. JayD7217 Lv 1 4 pts. 8,479
  3. Avatar for haabermaaster 93. haabermaaster Lv 1 4 pts. 8,464
  4. Avatar for SKSbell 94. SKSbell Lv 1 3 pts. 8,432
  5. Avatar for Alistair69 95. Alistair69 Lv 1 3 pts. 8,392
  6. Avatar for marsfan 96. marsfan Lv 1 3 pts. 8,379
  7. Avatar for cynwulf28 97. cynwulf28 Lv 1 3 pts. 8,368
  8. Avatar for karost 98. karost Lv 1 3 pts. 8,359
  9. Avatar for Jim Fraser 99. Jim Fraser Lv 1 3 pts. 8,354
  10. Avatar for parsnip 100. parsnip Lv 1 3 pts. 8,339

Comments