Placeholder image of a protein
Icon representing a puzzle

1307: Unsolved De-novo Freestyle 90

Closed since over 9 years ago

Intermediate Overall Prediction

Summary

Created
November 11, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


QEKMERIRQRFEEDLKKDNNMEVHIHLHNNKIELRIRIGNEESRVEVRINGDELDIQVRNSGKTIEELIQRWKEEIKKIV

Top groups

  1. Avatar for Eὕρηκα! Heureka! 11. Eὕρηκα! Heureka! 1 pt. 7,783
  2. Avatar for BiboKids 12. BiboKids 1 pt. 7,413
  3. Avatar for Freeport Honors Biology 13. Freeport Honors Biology 1 pt. 7,124
  4. Avatar for Deleted group 14. Deleted group pts. 6,871
  5. Avatar for AST Biology 15. AST Biology 1 pt. 6,281
  6. Avatar for Russian team 16. Russian team 1 pt. 5,907
  7. Avatar for DSN @ Home 17. DSN @ Home 1 pt. 5,465
  1. Avatar for Hollinas 101. Hollinas Lv 1 2 pts. 8,319
  2. Avatar for Merf 102. Merf Lv 1 2 pts. 8,310
  3. Avatar for Kiwegapa 103. Kiwegapa Lv 1 2 pts. 8,308
  4. Avatar for mitarcher 104. mitarcher Lv 1 2 pts. 8,247
  5. Avatar for gilleain 105. gilleain Lv 1 2 pts. 8,236
  6. Avatar for rezaefar 106. rezaefar Lv 1 2 pts. 8,229
  7. Avatar for placid.lion 107. placid.lion Lv 1 2 pts. 8,229
  8. Avatar for NotJim99 108. NotJim99 Lv 1 2 pts. 8,191
  9. Avatar for bx7gn 109. bx7gn Lv 1 2 pts. 8,179
  10. Avatar for poiuyqwert 110. poiuyqwert Lv 1 2 pts. 8,168

Comments