Placeholder image of a protein
Icon representing a puzzle

1307: Unsolved De-novo Freestyle 90

Closed since over 9 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
November 11, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


QEKMERIRQRFEEDLKKDNNMEVHIHLHNNKIELRIRIGNEESRVEVRINGDELDIQVRNSGKTIEELIQRWKEEIKKIV

Top groups


  1. Avatar for Contenders 100 pts. 9,530
  2. Avatar for Go Science 2. Go Science 73 pts. 9,517
  3. Avatar for Gargleblasters 3. Gargleblasters 52 pts. 9,495
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 36 pts. 9,494
  5. Avatar for Beta Folders 5. Beta Folders 24 pts. 9,468
  6. Avatar for Void Crushers 6. Void Crushers 16 pts. 9,453
  7. Avatar for Deleted group 7. Deleted group pts. 9,448
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 6 pts. 9,396
  9. Avatar for xkcd 9. xkcd 4 pts. 9,287
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 2 pts. 8,464

  1. Avatar for Hollinas 101. Hollinas Lv 1 2 pts. 8,319
  2. Avatar for Merf 102. Merf Lv 1 2 pts. 8,310
  3. Avatar for Kiwegapa 103. Kiwegapa Lv 1 2 pts. 8,308
  4. Avatar for mitarcher 104. mitarcher Lv 1 2 pts. 8,247
  5. Avatar for gilleain 105. gilleain Lv 1 2 pts. 8,236
  6. Avatar for rezaefar 106. rezaefar Lv 1 2 pts. 8,229
  7. Avatar for placid.lion 107. placid.lion Lv 1 2 pts. 8,229
  8. Avatar for NotJim99 108. NotJim99 Lv 1 2 pts. 8,191
  9. Avatar for bx7gn 109. bx7gn Lv 1 2 pts. 8,179
  10. Avatar for poiuyqwert 110. poiuyqwert Lv 1 2 pts. 8,168

Comments