Placeholder image of a protein
Icon representing a puzzle

1307: Unsolved De-novo Freestyle 90

Closed since over 9 years ago

Intermediate Overall Prediction

Summary


Created
November 11, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


QEKMERIRQRFEEDLKKDNNMEVHIHLHNNKIELRIRIGNEESRVEVRINGDELDIQVRNSGKTIEELIQRWKEEIKKIV

Top groups


  1. Avatar for Eὕρηκα! Heureka! 11. Eὕρηκα! Heureka! 1 pt. 7,783
  2. Avatar for BiboKids 12. BiboKids 1 pt. 7,413
  3. Avatar for Deleted group 14. Deleted group pts. 6,871
  4. Avatar for AST Biology 15. AST Biology 1 pt. 6,281
  5. Avatar for Russian team 16. Russian team 1 pt. 5,907
  6. Avatar for DSN @ Home 17. DSN @ Home 1 pt. 5,465

  1. Avatar for Sydefecks 111. Sydefecks Lv 1 2 pts. 8,150
  2. Avatar for jamiexq 112. jamiexq Lv 1 1 pt. 8,143
  3. Avatar for Psych0Active 113. Psych0Active Lv 1 1 pt. 8,135
  4. Avatar for asperger1993 114. asperger1993 Lv 1 1 pt. 8,104
  5. Avatar for The_Lunar_1 115. The_Lunar_1 Lv 1 1 pt. 8,096
  6. Avatar for carsonfb 116. carsonfb Lv 1 1 pt. 8,086
  7. Avatar for JUMELLE54 117. JUMELLE54 Lv 1 1 pt. 8,073
  8. Avatar for 01010011111 118. 01010011111 Lv 1 1 pt. 8,070
  9. Avatar for SouperGenious 119. SouperGenious Lv 1 1 pt. 7,996
  10. Avatar for johngran2 120. johngran2 Lv 1 1 pt. 7,915

Comments