Placeholder image of a protein
Icon representing a puzzle

1307: Unsolved De-novo Freestyle 90

Closed since over 9 years ago

Intermediate Overall Prediction

Summary

Created
November 11, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


QEKMERIRQRFEEDLKKDNNMEVHIHLHNNKIELRIRIGNEESRVEVRINGDELDIQVRNSGKTIEELIQRWKEEIKKIV

Top groups

  1. Avatar for Contenders
    1. Contenders
    100 pts. 9,530
  2. Avatar for Go Science 2. Go Science 73 pts. 9,517
  3. Avatar for Gargleblasters 3. Gargleblasters 52 pts. 9,495
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 36 pts. 9,494
  5. Avatar for Beta Folders 5. Beta Folders 24 pts. 9,468
  6. Avatar for Void Crushers 6. Void Crushers 16 pts. 9,453
  7. Avatar for Deleted group 7. Deleted group pts. 9,448
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 6 pts. 9,396
  9. Avatar for xkcd 9. xkcd 4 pts. 9,287
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 2 pts. 8,464
  1. Avatar for Sydefecks 111. Sydefecks Lv 1 2 pts. 8,150
  2. Avatar for jamiexq 112. jamiexq Lv 1 1 pt. 8,143
  3. Avatar for Psych0Active 113. Psych0Active Lv 1 1 pt. 8,135
  4. Avatar for asperger1993 114. asperger1993 Lv 1 1 pt. 8,104
  5. Avatar for The_Lunar_1 115. The_Lunar_1 Lv 1 1 pt. 8,096
  6. Avatar for carsonfb 116. carsonfb Lv 1 1 pt. 8,086
  7. Avatar for JUMELLE54 117. JUMELLE54 Lv 1 1 pt. 8,073
  8. Avatar for 01010011111 118. 01010011111 Lv 1 1 pt. 8,070
  9. Avatar for SouperGenious 119. SouperGenious Lv 1 1 pt. 7,996
  10. Avatar for johngran2 120. johngran2 Lv 1 1 pt. 7,915

Comments