Placeholder image of a protein
Icon representing a puzzle

1307: Unsolved De-novo Freestyle 90

Closed since over 9 years ago

Intermediate Overall Prediction

Summary

Created
November 11, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


QEKMERIRQRFEEDLKKDNNMEVHIHLHNNKIELRIRIGNEESRVEVRINGDELDIQVRNSGKTIEELIQRWKEEIKKIV

Top groups

  1. Avatar for Eὕρηκα! Heureka! 11. Eὕρηκα! Heureka! 1 pt. 7,783
  2. Avatar for BiboKids 12. BiboKids 1 pt. 7,413
  3. Avatar for Freeport Honors Biology 13. Freeport Honors Biology 1 pt. 7,124
  4. Avatar for Deleted group 14. Deleted group pts. 6,871
  5. Avatar for AST Biology 15. AST Biology 1 pt. 6,281
  6. Avatar for Russian team 16. Russian team 1 pt. 5,907
  7. Avatar for DSN @ Home 17. DSN @ Home 1 pt. 5,465
  1. Avatar for khendarg 141. khendarg Lv 1 1 pt. 7,066
  2. Avatar for andrewxc 142. andrewxc Lv 1 1 pt. 6,968
  3. Avatar for Cerzax 143. Cerzax Lv 1 1 pt. 6,963
  4. Avatar for bullmoose3 144. bullmoose3 Lv 1 1 pt. 6,948
  5. Avatar for judyanncocadiz 145. judyanncocadiz Lv 1 1 pt. 6,938
  6. Avatar for JW4LAM 146. JW4LAM Lv 1 1 pt. 6,871
  7. Avatar for Ashrai 147. Ashrai Lv 1 1 pt. 6,823
  8. Avatar for ekafloro 148. ekafloro Lv 1 1 pt. 6,807
  9. Avatar for EZdoesitagain 149. EZdoesitagain Lv 1 1 pt. 6,771
  10. Avatar for tweak64 150. tweak64 Lv 1 1 pt. 6,682

Comments