Placeholder image of a protein
Icon representing a puzzle

1307: Unsolved De-novo Freestyle 90

Closed since over 9 years ago

Intermediate Overall Prediction

Summary

Created
November 11, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


QEKMERIRQRFEEDLKKDNNMEVHIHLHNNKIELRIRIGNEESRVEVRINGDELDIQVRNSGKTIEELIQRWKEEIKKIV

Top groups

  1. Avatar for Contenders
    1. Contenders
    100 pts. 9,530
  2. Avatar for Go Science 2. Go Science 73 pts. 9,517
  3. Avatar for Gargleblasters 3. Gargleblasters 52 pts. 9,495
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 36 pts. 9,494
  5. Avatar for Beta Folders 5. Beta Folders 24 pts. 9,468
  6. Avatar for Void Crushers 6. Void Crushers 16 pts. 9,453
  7. Avatar for Deleted group 7. Deleted group pts. 9,448
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 6 pts. 9,396
  9. Avatar for xkcd 9. xkcd 4 pts. 9,287
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 2 pts. 8,464
  1. Avatar for khendarg 141. khendarg Lv 1 1 pt. 7,066
  2. Avatar for andrewxc 142. andrewxc Lv 1 1 pt. 6,968
  3. Avatar for Cerzax 143. Cerzax Lv 1 1 pt. 6,963
  4. Avatar for bullmoose3 144. bullmoose3 Lv 1 1 pt. 6,948
  5. Avatar for judyanncocadiz 145. judyanncocadiz Lv 1 1 pt. 6,938
  6. Avatar for JW4LAM 146. JW4LAM Lv 1 1 pt. 6,871
  7. Avatar for Ashrai 147. Ashrai Lv 1 1 pt. 6,823
  8. Avatar for ekafloro 148. ekafloro Lv 1 1 pt. 6,807
  9. Avatar for EZdoesitagain 149. EZdoesitagain Lv 1 1 pt. 6,771
  10. Avatar for tweak64 150. tweak64 Lv 1 1 pt. 6,682

Comments