Placeholder image of a protein
Icon representing a puzzle

1307: Unsolved De-novo Freestyle 90

Closed since over 9 years ago

Intermediate Overall Prediction

Summary

Created
November 11, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


QEKMERIRQRFEEDLKKDNNMEVHIHLHNNKIELRIRIGNEESRVEVRINGDELDIQVRNSGKTIEELIQRWKEEIKKIV

Top groups

  1. Avatar for Eὕρηκα! Heureka! 11. Eὕρηκα! Heureka! 1 pt. 7,783
  2. Avatar for BiboKids 12. BiboKids 1 pt. 7,413
  3. Avatar for Freeport Honors Biology 13. Freeport Honors Biology 1 pt. 7,124
  4. Avatar for Deleted group 14. Deleted group pts. 6,871
  5. Avatar for AST Biology 15. AST Biology 1 pt. 6,281
  6. Avatar for Russian team 16. Russian team 1 pt. 5,907
  7. Avatar for DSN @ Home 17. DSN @ Home 1 pt. 5,465
  1. Avatar for demeter900 151. demeter900 Lv 1 1 pt. 6,555
  2. Avatar for optimus_f_prime 152. optimus_f_prime Lv 1 1 pt. 6,529
  3. Avatar for xplocast1 153. xplocast1 Lv 1 1 pt. 6,427
  4. Avatar for racingsnailrider 154. racingsnailrider Lv 1 1 pt. 6,395
  5. Avatar for Planttrekkie 155. Planttrekkie Lv 1 1 pt. 6,370
  6. Avatar for ragestorm 156. ragestorm Lv 1 1 pt. 6,341
  7. Avatar for pedroea0 157. pedroea0 Lv 1 1 pt. 6,281
  8. Avatar for hansvandenhof 158. hansvandenhof Lv 1 1 pt. 6,233
  9. Avatar for roandavila 159. roandavila Lv 1 1 pt. 6,167
  10. Avatar for yba130 160. yba130 Lv 1 1 pt. 6,064

Comments