Placeholder image of a protein
Icon representing a puzzle

1307: Unsolved De-novo Freestyle 90

Closed since over 9 years ago

Intermediate Overall Prediction

Summary

Created
November 11, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


QEKMERIRQRFEEDLKKDNNMEVHIHLHNNKIELRIRIGNEESRVEVRINGDELDIQVRNSGKTIEELIQRWKEEIKKIV

Top groups

  1. Avatar for Contenders
    1. Contenders
    100 pts. 9,530
  2. Avatar for Go Science 2. Go Science 73 pts. 9,517
  3. Avatar for Gargleblasters 3. Gargleblasters 52 pts. 9,495
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 36 pts. 9,494
  5. Avatar for Beta Folders 5. Beta Folders 24 pts. 9,468
  6. Avatar for Void Crushers 6. Void Crushers 16 pts. 9,453
  7. Avatar for Deleted group 7. Deleted group pts. 9,448
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 6 pts. 9,396
  9. Avatar for xkcd 9. xkcd 4 pts. 9,287
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 2 pts. 8,464
  1. Avatar for demeter900 151. demeter900 Lv 1 1 pt. 6,555
  2. Avatar for optimus_f_prime 152. optimus_f_prime Lv 1 1 pt. 6,529
  3. Avatar for xplocast1 153. xplocast1 Lv 1 1 pt. 6,427
  4. Avatar for racingsnailrider 154. racingsnailrider Lv 1 1 pt. 6,395
  5. Avatar for Planttrekkie 155. Planttrekkie Lv 1 1 pt. 6,370
  6. Avatar for ragestorm 156. ragestorm Lv 1 1 pt. 6,341
  7. Avatar for pedroea0 157. pedroea0 Lv 1 1 pt. 6,281
  8. Avatar for hansvandenhof 158. hansvandenhof Lv 1 1 pt. 6,233
  9. Avatar for roandavila 159. roandavila Lv 1 1 pt. 6,167
  10. Avatar for yba130 160. yba130 Lv 1 1 pt. 6,064

Comments