Placeholder image of a protein
Icon representing a puzzle

1307: Unsolved De-novo Freestyle 90

Closed since over 9 years ago

Intermediate Overall Prediction

Summary

Created
November 11, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


QEKMERIRQRFEEDLKKDNNMEVHIHLHNNKIELRIRIGNEESRVEVRINGDELDIQVRNSGKTIEELIQRWKEEIKKIV

Top groups

  1. Avatar for Eὕρηκα! Heureka! 11. Eὕρηκα! Heureka! 1 pt. 7,783
  2. Avatar for BiboKids 12. BiboKids 1 pt. 7,413
  3. Avatar for Freeport Honors Biology 13. Freeport Honors Biology 1 pt. 7,124
  4. Avatar for Deleted group 14. Deleted group pts. 6,871
  5. Avatar for AST Biology 15. AST Biology 1 pt. 6,281
  6. Avatar for Russian team 16. Russian team 1 pt. 5,907
  7. Avatar for DSN @ Home 17. DSN @ Home 1 pt. 5,465
  1. Avatar for caglar 31. caglar Lv 1 42 pts. 9,346
  2. Avatar for Sporeo 32. Sporeo Lv 1 40 pts. 9,346
  3. Avatar for gitwut 33. gitwut Lv 1 39 pts. 9,345
  4. Avatar for alcor29 34. alcor29 Lv 1 38 pts. 9,335
  5. Avatar for nicobul 35. nicobul Lv 1 37 pts. 9,318
  6. Avatar for reefyrob 36. reefyrob Lv 1 35 pts. 9,312
  7. Avatar for smilingone 37. smilingone Lv 1 34 pts. 9,305
  8. Avatar for TomTaylor 38. TomTaylor Lv 1 33 pts. 9,301
  9. Avatar for spvincent 39. spvincent Lv 1 32 pts. 9,300
  10. Avatar for fryguy 40. fryguy Lv 1 31 pts. 9,287

Comments