Placeholder image of a protein
Icon representing a puzzle

1307: Unsolved De-novo Freestyle 90

Closed since over 9 years ago

Intermediate Overall Prediction

Summary

Created
November 11, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


QEKMERIRQRFEEDLKKDNNMEVHIHLHNNKIELRIRIGNEESRVEVRINGDELDIQVRNSGKTIEELIQRWKEEIKKIV

Top groups

  1. Avatar for Contenders
    1. Contenders
    100 pts. 9,530
  2. Avatar for Go Science 2. Go Science 73 pts. 9,517
  3. Avatar for Gargleblasters 3. Gargleblasters 52 pts. 9,495
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 36 pts. 9,494
  5. Avatar for Beta Folders 5. Beta Folders 24 pts. 9,468
  6. Avatar for Void Crushers 6. Void Crushers 16 pts. 9,453
  7. Avatar for Deleted group 7. Deleted group pts. 9,448
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 6 pts. 9,396
  9. Avatar for xkcd 9. xkcd 4 pts. 9,287
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 2 pts. 8,464
  1. Avatar for caglar 31. caglar Lv 1 42 pts. 9,346
  2. Avatar for Sporeo 32. Sporeo Lv 1 40 pts. 9,346
  3. Avatar for gitwut 33. gitwut Lv 1 39 pts. 9,345
  4. Avatar for alcor29 34. alcor29 Lv 1 38 pts. 9,335
  5. Avatar for nicobul 35. nicobul Lv 1 37 pts. 9,318
  6. Avatar for reefyrob 36. reefyrob Lv 1 35 pts. 9,312
  7. Avatar for smilingone 37. smilingone Lv 1 34 pts. 9,305
  8. Avatar for TomTaylor 38. TomTaylor Lv 1 33 pts. 9,301
  9. Avatar for spvincent 39. spvincent Lv 1 32 pts. 9,300
  10. Avatar for fryguy 40. fryguy Lv 1 31 pts. 9,287

Comments