Placeholder image of a protein
Icon representing a puzzle

1307: Unsolved De-novo Freestyle 90

Closed since over 9 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
November 11, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


QEKMERIRQRFEEDLKKDNNMEVHIHLHNNKIELRIRIGNEESRVEVRINGDELDIQVRNSGKTIEELIQRWKEEIKKIV

Top groups


  1. Avatar for Eὕρηκα! Heureka! 11. Eὕρηκα! Heureka! 1 pt. 7,783
  2. Avatar for BiboKids 12. BiboKids 1 pt. 7,413
  3. Avatar for Deleted group 14. Deleted group pts. 6,871
  4. Avatar for AST Biology 15. AST Biology 1 pt. 6,281
  5. Avatar for Russian team 16. Russian team 1 pt. 5,907
  6. Avatar for DSN @ Home 17. DSN @ Home 1 pt. 5,465

  1. Avatar for pauldunn 41. pauldunn Lv 1 30 pts. 9,277
  2. Avatar for bendbob 42. bendbob Lv 1 29 pts. 9,275
  3. Avatar for gurch 43. gurch Lv 1 28 pts. 9,269
  4. Avatar for Bletchley Park 44. Bletchley Park Lv 1 27 pts. 9,265
  5. Avatar for kabubi 45. kabubi Lv 1 26 pts. 9,252
  6. Avatar for jobo0502 46. jobo0502 Lv 1 25 pts. 9,246
  7. Avatar for LociOiling 47. LociOiling Lv 1 24 pts. 9,241
  8. Avatar for g_b 48. g_b Lv 1 23 pts. 9,228
  9. Avatar for meatexplosion 49. meatexplosion Lv 1 23 pts. 9,211
  10. Avatar for Deleted player 50. Deleted player pts. 9,210

Comments