Placeholder image of a protein
Icon representing a puzzle

1307: Unsolved De-novo Freestyle 90

Closed since over 9 years ago

Intermediate Overall Prediction

Summary

Created
November 11, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


QEKMERIRQRFEEDLKKDNNMEVHIHLHNNKIELRIRIGNEESRVEVRINGDELDIQVRNSGKTIEELIQRWKEEIKKIV

Top groups

  1. Avatar for Contenders
    1. Contenders
    100 pts. 9,530
  2. Avatar for Go Science 2. Go Science 73 pts. 9,517
  3. Avatar for Gargleblasters 3. Gargleblasters 52 pts. 9,495
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 36 pts. 9,494
  5. Avatar for Beta Folders 5. Beta Folders 24 pts. 9,468
  6. Avatar for Void Crushers 6. Void Crushers 16 pts. 9,453
  7. Avatar for Deleted group 7. Deleted group pts. 9,448
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 6 pts. 9,396
  9. Avatar for xkcd 9. xkcd 4 pts. 9,287
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 2 pts. 8,464
  1. Avatar for pauldunn 41. pauldunn Lv 1 30 pts. 9,277
  2. Avatar for bendbob 42. bendbob Lv 1 29 pts. 9,275
  3. Avatar for gurch 43. gurch Lv 1 28 pts. 9,269
  4. Avatar for Bletchley Park 44. Bletchley Park Lv 1 27 pts. 9,265
  5. Avatar for kabubi 45. kabubi Lv 1 26 pts. 9,252
  6. Avatar for jobo0502 46. jobo0502 Lv 1 25 pts. 9,246
  7. Avatar for LociOiling 47. LociOiling Lv 1 24 pts. 9,241
  8. Avatar for g_b 48. g_b Lv 1 23 pts. 9,228
  9. Avatar for meatexplosion 49. meatexplosion Lv 1 23 pts. 9,211
  10. Avatar for Deleted player 50. Deleted player pts. 9,210

Comments