Placeholder image of a protein
Icon representing a puzzle

1307: Unsolved De-novo Freestyle 90

Closed since over 9 years ago

Intermediate Overall Prediction

Summary

Created
November 11, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


QEKMERIRQRFEEDLKKDNNMEVHIHLHNNKIELRIRIGNEESRVEVRINGDELDIQVRNSGKTIEELIQRWKEEIKKIV

Top groups

  1. Avatar for Eὕρηκα! Heureka! 11. Eὕρηκα! Heureka! 1 pt. 7,783
  2. Avatar for BiboKids 12. BiboKids 1 pt. 7,413
  3. Avatar for Freeport Honors Biology 13. Freeport Honors Biology 1 pt. 7,124
  4. Avatar for Deleted group 14. Deleted group pts. 6,871
  5. Avatar for AST Biology 15. AST Biology 1 pt. 6,281
  6. Avatar for Russian team 16. Russian team 1 pt. 5,907
  7. Avatar for DSN @ Home 17. DSN @ Home 1 pt. 5,465
  1. Avatar for tallguy-13088 81. tallguy-13088 Lv 1 6 pts. 8,777
  2. Avatar for alwen 82. alwen Lv 1 6 pts. 8,767
  3. Avatar for Mike Lewis 83. Mike Lewis Lv 1 6 pts. 8,727
  4. Avatar for phi16 84. phi16 Lv 1 5 pts. 8,702
  5. Avatar for pfirth 85. pfirth Lv 1 5 pts. 8,621
  6. Avatar for dbuske 86. dbuske Lv 1 5 pts. 8,616
  7. Avatar for fishercat 87. fishercat Lv 1 5 pts. 8,614
  8. Avatar for pmdpmd 88. pmdpmd Lv 1 5 pts. 8,517
  9. Avatar for MicElephant 89. MicElephant Lv 1 4 pts. 8,515
  10. Avatar for heather-1 90. heather-1 Lv 1 4 pts. 8,512

Comments