Placeholder image of a protein
Icon representing a puzzle

1307: Unsolved De-novo Freestyle 90

Closed since over 9 years ago

Intermediate Overall Prediction

Summary

Created
November 11, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


QEKMERIRQRFEEDLKKDNNMEVHIHLHNNKIELRIRIGNEESRVEVRINGDELDIQVRNSGKTIEELIQRWKEEIKKIV

Top groups

  1. Avatar for Contenders
    1. Contenders
    100 pts. 9,530
  2. Avatar for Go Science 2. Go Science 73 pts. 9,517
  3. Avatar for Gargleblasters 3. Gargleblasters 52 pts. 9,495
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 36 pts. 9,494
  5. Avatar for Beta Folders 5. Beta Folders 24 pts. 9,468
  6. Avatar for Void Crushers 6. Void Crushers 16 pts. 9,453
  7. Avatar for Deleted group 7. Deleted group pts. 9,448
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 6 pts. 9,396
  9. Avatar for xkcd 9. xkcd 4 pts. 9,287
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 2 pts. 8,464
  1. Avatar for tallguy-13088 81. tallguy-13088 Lv 1 6 pts. 8,777
  2. Avatar for alwen 82. alwen Lv 1 6 pts. 8,767
  3. Avatar for Mike Lewis 83. Mike Lewis Lv 1 6 pts. 8,727
  4. Avatar for phi16 84. phi16 Lv 1 5 pts. 8,702
  5. Avatar for pfirth 85. pfirth Lv 1 5 pts. 8,621
  6. Avatar for dbuske 86. dbuske Lv 1 5 pts. 8,616
  7. Avatar for fishercat 87. fishercat Lv 1 5 pts. 8,614
  8. Avatar for pmdpmd 88. pmdpmd Lv 1 5 pts. 8,517
  9. Avatar for MicElephant 89. MicElephant Lv 1 4 pts. 8,515
  10. Avatar for heather-1 90. heather-1 Lv 1 4 pts. 8,512

Comments