Placeholder image of a protein
Icon representing a puzzle

1308: Revisiting Puzzle 77: Copper Chaperone

Closed since over 9 years ago

Intermediate Overall Prediction

Summary

Created
November 21, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein binds copper ions so that they may be transported safely to the cell compartments and enzymes that require them. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AQEFSVKGMSCNHCVARIEEAVGRISGVKKVKVQLKKEKAVVKFDEANVQATEICQAINELGYQAEVI

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 9,196
  2. Avatar for Beta Folders 2. Beta Folders 80 pts. 9,186
  3. Avatar for Gargleblasters 3. Gargleblasters 63 pts. 9,139
  4. Avatar for Go Science 4. Go Science 49 pts. 9,126
  5. Avatar for Void Crushers 5. Void Crushers 37 pts. 9,111
  6. Avatar for Contenders 6. Contenders 28 pts. 9,103
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 21 pts. 9,077
  8. Avatar for Deleted group 8. Deleted group pts. 9,054
  9. Avatar for Russian team 9. Russian team 11 pts. 8,970
  10. Avatar for Eὕρηκα! Heureka! 10. Eὕρηκα! Heureka! 8 pts. 8,945
  1. Avatar for bhfreagra 121. bhfreagra Lv 1 3 pts. 8,650
  2. Avatar for senor pit 122. senor pit Lv 1 3 pts. 8,645
  3. Avatar for cnhrcolemam 123. cnhrcolemam Lv 1 3 pts. 8,628
  4. Avatar for ManVsYard 124. ManVsYard Lv 1 2 pts. 8,625
  5. Avatar for Deleted player 125. Deleted player pts. 8,618
  6. Avatar for t012 126. t012 Lv 1 2 pts. 8,616
  7. Avatar for demeter900 127. demeter900 Lv 1 2 pts. 8,615
  8. Avatar for morris3190 128. morris3190 Lv 1 2 pts. 8,610
  9. Avatar for Mike Cassidy 129. Mike Cassidy Lv 1 2 pts. 8,609
  10. Avatar for Hollinas 130. Hollinas Lv 1 2 pts. 8,608

Comments