Placeholder image of a protein
Icon representing a puzzle

1308: Revisiting Puzzle 77: Copper Chaperone

Closed since over 9 years ago

Intermediate Overall Prediction

Summary

Created
November 21, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein binds copper ions so that they may be transported safely to the cell compartments and enzymes that require them. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AQEFSVKGMSCNHCVARIEEAVGRISGVKKVKVQLKKEKAVVKFDEANVQATEICQAINELGYQAEVI

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 9,196
  2. Avatar for Beta Folders 2. Beta Folders 80 pts. 9,186
  3. Avatar for Gargleblasters 3. Gargleblasters 63 pts. 9,139
  4. Avatar for Go Science 4. Go Science 49 pts. 9,126
  5. Avatar for Void Crushers 5. Void Crushers 37 pts. 9,111
  6. Avatar for Contenders 6. Contenders 28 pts. 9,103
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 21 pts. 9,077
  8. Avatar for Deleted group 8. Deleted group pts. 9,054
  9. Avatar for Russian team 9. Russian team 11 pts. 8,970
  10. Avatar for Eὕρηκα! Heureka! 10. Eὕρηκα! Heureka! 8 pts. 8,945
  1. Avatar for JW4LAM 151. JW4LAM Lv 1 1 pt. 8,496
  2. Avatar for Olyndar 152. Olyndar Lv 1 1 pt. 8,495
  3. Avatar for Imeturoran 153. Imeturoran Lv 1 1 pt. 8,487
  4. Avatar for leehaggis 154. leehaggis Lv 1 1 pt. 8,487
  5. Avatar for tweak64 155. tweak64 Lv 1 1 pt. 8,484
  6. Avatar for poiuyqwert 156. poiuyqwert Lv 1 1 pt. 8,484
  7. Avatar for anonycat 157. anonycat Lv 1 1 pt. 8,477
  8. Avatar for momadoc 158. momadoc Lv 1 1 pt. 8,452
  9. Avatar for ZiiONIC 159. ZiiONIC Lv 1 1 pt. 8,443
  10. Avatar for jebbiek 160. jebbiek Lv 1 1 pt. 8,430

Comments