1308: Revisiting Puzzle 77: Copper Chaperone

Closed since over 9 years ago

Summary

• Created: November 21, 2016
• Expires: November 29, 2016 at 23:00 UTC
• Max points: 100

Description

This is a throwback puzzle to the early days of Foldit. This protein binds copper ions so that they may be transported safely to the cell compartments and enzymes that require them. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

AQEFSVKGMSCNHCVARIEEAVGRISGVKKVKVQLKKEKAVVKFDEANVQATEICQAINELGYQAEVI

Top groups

• 1. Anthropic Dreams 100 pts. 9,196
• 2. Beta Folders 80 pts. 9,186
• 3. Gargleblasters 63 pts. 9,139
• 4. Go Science 49 pts. 9,126
• 5. Void Crushers 37 pts. 9,111
• 6. Contenders 28 pts. 9,103
• 7. L'Alliance Francophone 21 pts. 9,077
• 8. Deleted group pts. 9,054
• 9. Russian team 11 pts. 8,970
• 10. Eὕρηκα! Heureka! 8 pts. 8,945

Top soloists

• 11. ZeroLeak7 80 pts. 9,126
• 12. Bruno Kestemont 78 pts. 9,125
• 13. Scopper 77 pts. 9,122
• 14. Vredeman 75 pts. 9,112
• 15. Timo van der Laan 73 pts. 9,111
• 16. Susume 71 pts. 9,110
• 17. actiasluna 70 pts. 9,103
• 18. gitwut 68 pts. 9,102
• 19. Aubade01 66 pts. 9,084
• 20. Museka 65 pts. 9,077