Placeholder image of a protein
Icon representing a puzzle

1308: Revisiting Puzzle 77: Copper Chaperone

Closed since over 9 years ago

Intermediate Overall Prediction

Summary

Created
November 21, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein binds copper ions so that they may be transported safely to the cell compartments and enzymes that require them. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AQEFSVKGMSCNHCVARIEEAVGRISGVKKVKVQLKKEKAVVKFDEANVQATEICQAINELGYQAEVI

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 9,196
  2. Avatar for Beta Folders 2. Beta Folders 80 pts. 9,186
  3. Avatar for Gargleblasters 3. Gargleblasters 63 pts. 9,139
  4. Avatar for Go Science 4. Go Science 49 pts. 9,126
  5. Avatar for Void Crushers 5. Void Crushers 37 pts. 9,111
  6. Avatar for Contenders 6. Contenders 28 pts. 9,103
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 21 pts. 9,077
  8. Avatar for Deleted group 8. Deleted group pts. 9,054
  9. Avatar for Russian team 9. Russian team 11 pts. 8,970
  10. Avatar for Eὕρηκα! Heureka! 10. Eὕρηκα! Heureka! 8 pts. 8,945
  1. Avatar for aspadistra 171. aspadistra Lv 1 1 pt. 8,261
  2. Avatar for icedes 172. icedes Lv 1 1 pt. 8,257
  3. Avatar for @lison 173. @lison Lv 1 1 pt. 8,239
  4. Avatar for brenolisboa 174. brenolisboa Lv 1 1 pt. 8,205
  5. Avatar for mirjamvandelft 175. mirjamvandelft Lv 1 1 pt. 8,196
  6. Avatar for Piup 176. Piup Lv 1 1 pt. 8,196
  7. Avatar for cadoy 177. cadoy Lv 1 1 pt. 8,191
  8. Avatar for doctaven 178. doctaven Lv 1 1 pt. 8,187
  9. Avatar for loven-doo 179. loven-doo Lv 1 1 pt. 8,170
  10. Avatar for toki08202 180. toki08202 Lv 1 1 pt. 8,155

Comments