Placeholder image of a protein
Icon representing a puzzle

1314: Revisiting Puzzle 80: Calcium Channel Blocker

Closed since over 9 years ago

Intermediate Overall Prediction

Summary


Created
December 06, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is found in green mamba venom, and blocks the flow of calcium ions that normally depolarize the muscle cell to induce muscle contraction. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


WQPPWYCKEPVRIGSCKKQFSSFYFKWTAKKCLPFLFSGCGGNANRFQTIGECRKKCLGK

Top groups


  1. Avatar for Deleted group 11. Deleted group pts. 8,632
  2. Avatar for xkcd 12. xkcd 1 pt. 8,623
  3. Avatar for freefolder 13. freefolder 1 pt. 8,519
  4. Avatar for Russian team 14. Russian team 1 pt. 8,484
  5. Avatar for Deleted group 15. Deleted group pts. 8,464
  6. Avatar for SETI.Germany 16. SETI.Germany 1 pt. 8,459
  7. Avatar for DSN @ Home 18. DSN @ Home 1 pt. 8,014
  8. Avatar for Window Group 19. Window Group 1 pt. 3,942

  1. Avatar for Fat Tony 121. Fat Tony Lv 1 1 pt. 8,247
  2. Avatar for ppp6 122. ppp6 Lv 1 1 pt. 8,242
  3. Avatar for Hollinas 123. Hollinas Lv 1 1 pt. 8,226
  4. Avatar for tweak64 124. tweak64 Lv 1 1 pt. 8,223
  5. Avatar for hapalops 125. hapalops Lv 1 1 pt. 8,215
  6. Avatar for senor pit 126. senor pit Lv 1 1 pt. 8,213
  7. Avatar for monkry 127. monkry Lv 1 1 pt. 8,210
  8. Avatar for Ref_Jo 128. Ref_Jo Lv 1 1 pt. 8,187
  9. Avatar for Iron pet 129. Iron pet Lv 1 1 pt. 8,182
  10. Avatar for books223 130. books223 Lv 1 1 pt. 8,175

Comments