Placeholder image of a protein
Icon representing a puzzle

1314: Revisiting Puzzle 80: Calcium Channel Blocker

Closed since over 9 years ago

Intermediate Overall Prediction

Summary


Created
December 06, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is found in green mamba venom, and blocks the flow of calcium ions that normally depolarize the muscle cell to induce muscle contraction. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


WQPPWYCKEPVRIGSCKKQFSSFYFKWTAKKCLPFLFSGCGGNANRFQTIGECRKKCLGK

Top groups


  1. Avatar for Deleted group 11. Deleted group pts. 8,632
  2. Avatar for xkcd 12. xkcd 1 pt. 8,623
  3. Avatar for freefolder 13. freefolder 1 pt. 8,519
  4. Avatar for Russian team 14. Russian team 1 pt. 8,484
  5. Avatar for Deleted group 15. Deleted group pts. 8,464
  6. Avatar for SETI.Germany 16. SETI.Germany 1 pt. 8,459
  7. Avatar for DSN @ Home 18. DSN @ Home 1 pt. 8,014
  8. Avatar for Window Group 19. Window Group 1 pt. 3,942

  1. Avatar for Kiwegapa 141. Kiwegapa Lv 1 1 pt. 8,031
  2. Avatar for aspadistra 142. aspadistra Lv 1 1 pt. 8,014
  3. Avatar for Sci1217 143. Sci1217 Lv 1 1 pt. 7,993
  4. Avatar for wolven_moonstone 144. wolven_moonstone Lv 1 1 pt. 7,921
  5. Avatar for martinf 145. martinf Lv 1 1 pt. 7,887
  6. Avatar for m.borden 146. m.borden Lv 1 1 pt. 7,871
  7. Avatar for traal 147. traal Lv 1 1 pt. 7,844
  8. Avatar for cherry39 148. cherry39 Lv 1 1 pt. 7,785
  9. Avatar for keith243 149. keith243 Lv 1 1 pt. 7,711
  10. Avatar for Tehnologik1 150. Tehnologik1 Lv 1 1 pt. 7,710

Comments