Placeholder image of a protein
Icon representing a puzzle

1314: Revisiting Puzzle 80: Calcium Channel Blocker

Closed since over 9 years ago

Intermediate Overall Prediction

Summary

Created
December 06, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is found in green mamba venom, and blocks the flow of calcium ions that normally depolarize the muscle cell to induce muscle contraction. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


WQPPWYCKEPVRIGSCKKQFSSFYFKWTAKKCLPFLFSGCGGNANRFQTIGECRKKCLGK

Top groups

  1. Avatar for Deleted group 11. Deleted group pts. 8,632
  2. Avatar for xkcd 12. xkcd 1 pt. 8,623
  3. Avatar for freefolder 13. freefolder 1 pt. 8,519
  4. Avatar for Russian team 14. Russian team 1 pt. 8,484
  5. Avatar for Deleted group 15. Deleted group pts. 8,464
  6. Avatar for SETI.Germany 16. SETI.Germany 1 pt. 8,459
  7. Avatar for Freeport Honors Biology 17. Freeport Honors Biology 1 pt. 8,442
  8. Avatar for DSN @ Home 18. DSN @ Home 1 pt. 8,014
  9. Avatar for Window Group 19. Window Group 1 pt. 3,942
  1. Avatar for momadoc 151. momadoc Lv 1 1 pt. 7,675
  2. Avatar for naturacy 152. naturacy Lv 1 1 pt. 7,673
  3. Avatar for ZiiONIC 153. ZiiONIC Lv 1 1 pt. 7,642
  4. Avatar for brenolisboa 154. brenolisboa Lv 1 1 pt. 7,638
  5. Avatar for parsnip 155. parsnip Lv 1 1 pt. 7,617
  6. Avatar for Cerzax 156. Cerzax Lv 1 1 pt. 7,581
  7. Avatar for metafolder 157. metafolder Lv 1 1 pt. 7,579
  8. Avatar for Rhyslarn 158. Rhyslarn Lv 1 1 pt. 7,519
  9. Avatar for Appleman1214 159. Appleman1214 Lv 1 1 pt. 7,504
  10. Avatar for duncandude 160. duncandude Lv 1 1 pt. 7,455

Comments