Placeholder image of a protein
Icon representing a puzzle

1314: Revisiting Puzzle 80: Calcium Channel Blocker

Closed since over 9 years ago

Intermediate Overall Prediction

Summary


Created
December 06, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is found in green mamba venom, and blocks the flow of calcium ions that normally depolarize the muscle cell to induce muscle contraction. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


WQPPWYCKEPVRIGSCKKQFSSFYFKWTAKKCLPFLFSGCGGNANRFQTIGECRKKCLGK

Top groups


  1. Avatar for Deleted group 11. Deleted group pts. 8,632
  2. Avatar for xkcd 12. xkcd 1 pt. 8,623
  3. Avatar for freefolder 13. freefolder 1 pt. 8,519
  4. Avatar for Russian team 14. Russian team 1 pt. 8,484
  5. Avatar for Deleted group 15. Deleted group pts. 8,464
  6. Avatar for SETI.Germany 16. SETI.Germany 1 pt. 8,459
  7. Avatar for DSN @ Home 18. DSN @ Home 1 pt. 8,014
  8. Avatar for Window Group 19. Window Group 1 pt. 3,942

  1. Avatar for Hc820743 181. Hc820743 Lv 1 1 pt. 6,751
  2. Avatar for drumpeter18yrs9yrs 182. drumpeter18yrs9yrs Lv 1 1 pt. 6,621
  3. Avatar for dahast.de 183. dahast.de Lv 1 1 pt. 6,332
  4. Avatar for sor2018 184. sor2018 Lv 1 1 pt. 6,274
  5. Avatar for Johnne98 185. Johnne98 Lv 1 1 pt. 6,188
  6. Avatar for robkleffner 186. robkleffner Lv 1 1 pt. 5,720
  7. Avatar for haymanot 187. haymanot Lv 1 1 pt. 5,536
  8. Avatar for deuxpointzero 188. deuxpointzero Lv 1 1 pt. 5,137
  9. Avatar for jflat06 189. jflat06 Lv 1 1 pt. 3,942
  10. Avatar for oliver2a 190. oliver2a Lv 1 1 pt. 3,942

Comments