Placeholder image of a protein
Icon representing a puzzle

1314: Revisiting Puzzle 80: Calcium Channel Blocker

Closed since over 9 years ago

Intermediate Overall Prediction

Summary


Created
December 06, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is found in green mamba venom, and blocks the flow of calcium ions that normally depolarize the muscle cell to induce muscle contraction. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


WQPPWYCKEPVRIGSCKKQFSSFYFKWTAKKCLPFLFSGCGGNANRFQTIGECRKKCLGK

Top groups


  1. Avatar for Deleted group 11. Deleted group pts. 8,632
  2. Avatar for xkcd 12. xkcd 1 pt. 8,623
  3. Avatar for freefolder 13. freefolder 1 pt. 8,519
  4. Avatar for Russian team 14. Russian team 1 pt. 8,484
  5. Avatar for Deleted group 15. Deleted group pts. 8,464
  6. Avatar for SETI.Germany 16. SETI.Germany 1 pt. 8,459
  7. Avatar for DSN @ Home 18. DSN @ Home 1 pt. 8,014
  8. Avatar for Window Group 19. Window Group 1 pt. 3,942

  1. Avatar for stomjoh 51. stomjoh Lv 1 23 pts. 9,227
  2. Avatar for jamiexq 52. jamiexq Lv 1 22 pts. 9,219
  3. Avatar for alcor29 53. alcor29 Lv 1 22 pts. 9,193
  4. Avatar for caglar 54. caglar Lv 1 21 pts. 9,181
  5. Avatar for joremen 55. joremen Lv 1 20 pts. 9,180
  6. Avatar for Deleted player 56. Deleted player pts. 9,174
  7. Avatar for gurch 57. gurch Lv 1 19 pts. 9,158
  8. Avatar for tarimo 58. tarimo Lv 1 18 pts. 9,148
  9. Avatar for JayD7217 59. JayD7217 Lv 1 18 pts. 9,138
  10. Avatar for Norrjane 60. Norrjane Lv 1 17 pts. 9,128

Comments