Placeholder image of a protein
Icon representing a puzzle

1314: Revisiting Puzzle 80: Calcium Channel Blocker

Closed since over 9 years ago

Intermediate Overall Prediction

Summary

Created
December 06, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is found in green mamba venom, and blocks the flow of calcium ions that normally depolarize the muscle cell to induce muscle contraction. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


WQPPWYCKEPVRIGSCKKQFSSFYFKWTAKKCLPFLFSGCGGNANRFQTIGECRKKCLGK

Top groups

  1. Avatar for Contenders
    1. Contenders
    100 pts. 9,570
  2. Avatar for Beta Folders 2. Beta Folders 76 pts. 9,554
  3. Avatar for Gargleblasters 3. Gargleblasters 56 pts. 9,552
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 41 pts. 9,533
  5. Avatar for Go Science 5. Go Science 29 pts. 9,464
  6. Avatar for HMT heritage 6. HMT heritage 20 pts. 9,451
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 14 pts. 9,399
  8. Avatar for Void Crushers 8. Void Crushers 9 pts. 9,397
  9. Avatar for Italiani Al Lavoro 9. Italiani Al Lavoro 6 pts. 9,098
  10. Avatar for Deleted group 10. Deleted group pts. 8,784
  1. Avatar for pmdpmd 41. pmdpmd Lv 1 32 pts. 9,290
  2. Avatar for Museka 42. Museka Lv 1 31 pts. 9,283
  3. Avatar for georg137 43. georg137 Lv 1 30 pts. 9,272
  4. Avatar for MicElephant 44. MicElephant Lv 1 29 pts. 9,272
  5. Avatar for Vinara 45. Vinara Lv 1 28 pts. 9,265
  6. Avatar for phi16 46. phi16 Lv 1 27 pts. 9,264
  7. Avatar for guineapig 47. guineapig Lv 1 27 pts. 9,244
  8. Avatar for Deleted player 48. Deleted player pts. 9,239
  9. Avatar for pfirth 49. pfirth Lv 1 25 pts. 9,235
  10. Avatar for christioanchauvin 50. christioanchauvin Lv 1 24 pts. 9,233

Comments