Placeholder image of a protein
Icon representing a puzzle

1314: Revisiting Puzzle 80: Calcium Channel Blocker

Closed since over 9 years ago

Intermediate Overall Prediction

Summary

Created
December 06, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is found in green mamba venom, and blocks the flow of calcium ions that normally depolarize the muscle cell to induce muscle contraction. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


WQPPWYCKEPVRIGSCKKQFSSFYFKWTAKKCLPFLFSGCGGNANRFQTIGECRKKCLGK

Top groups

  1. Avatar for Contenders
    1. Contenders
    100 pts. 9,570
  2. Avatar for Beta Folders 2. Beta Folders 76 pts. 9,554
  3. Avatar for Gargleblasters 3. Gargleblasters 56 pts. 9,552
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 41 pts. 9,533
  5. Avatar for Go Science 5. Go Science 29 pts. 9,464
  6. Avatar for HMT heritage 6. HMT heritage 20 pts. 9,451
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 14 pts. 9,399
  8. Avatar for Void Crushers 8. Void Crushers 9 pts. 9,397
  9. Avatar for Italiani Al Lavoro 9. Italiani Al Lavoro 6 pts. 9,098
  10. Avatar for Deleted group 10. Deleted group pts. 8,784
  1. Avatar for diamonddays 61. diamonddays Lv 1 16 pts. 9,119
  2. Avatar for uihcv 62. uihcv Lv 1 16 pts. 9,118
  3. Avatar for hansvandenhof 63. hansvandenhof Lv 1 15 pts. 9,114
  4. Avatar for dbuske 64. dbuske Lv 1 15 pts. 9,102
  5. Avatar for Bushman 65. Bushman Lv 1 14 pts. 9,098
  6. Avatar for isaksson 66. isaksson Lv 1 14 pts. 9,080
  7. Avatar for WBarme1234 67. WBarme1234 Lv 1 13 pts. 9,059
  8. Avatar for johngran 68. johngran Lv 1 13 pts. 9,044
  9. Avatar for NinjaGreg 69. NinjaGreg Lv 1 12 pts. 9,042
  10. Avatar for alwen 70. alwen Lv 1 12 pts. 9,032

Comments