Placeholder image of a protein
Icon representing a puzzle

1318: Revisiting Puzzle 81: Calcium Ion Binding Protein

Closed since about 9 years ago

Intermediate Overall Prediction

Summary

Created
December 11, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, which inhibits muscle contraction in the absence of calcium ions, changes conformation in the presence of calcium to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


QAEARAFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for xkcd 11. xkcd 3 pts. 9,114
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 2 pts. 9,088
  3. Avatar for Russian team 13. Russian team 1 pt. 9,049
  4. Avatar for freefolder 14. freefolder 1 pt. 9,028
  5. Avatar for Kotocycle 15. Kotocycle 1 pt. 9,014
  6. Avatar for Freeport Honors Biology 16. Freeport Honors Biology 1 pt. 8,899
  7. Avatar for Deleted group 17. Deleted group pts. 8,732
  8. Avatar for R-MC Biochemistry 18. R-MC Biochemistry 1 pt. 8,449
  9. Avatar for Team South Africa 19. Team South Africa 1 pt. 8,293
  10. Avatar for DSN @ Home 20. DSN @ Home 1 pt. 8,060
  1. Avatar for gcm24 91. gcm24 Lv 1 6 pts. 9,062
  2. Avatar for navn 92. navn Lv 1 6 pts. 9,058
  3. Avatar for Darkly Deadpan 93. Darkly Deadpan Lv 1 6 pts. 9,055
  4. Avatar for jamiexq 94. jamiexq Lv 1 6 pts. 9,053
  5. Avatar for ComputerMage 95. ComputerMage Lv 1 6 pts. 9,049
  6. Avatar for Merf 96. Merf Lv 1 5 pts. 9,047
  7. Avatar for guineapig 97. guineapig Lv 1 5 pts. 9,042
  8. Avatar for katling 98. katling Lv 1 5 pts. 9,041
  9. Avatar for JUMELLE54 99. JUMELLE54 Lv 1 5 pts. 9,035
  10. Avatar for JayD7217 100. JayD7217 Lv 1 5 pts. 9,030

Comments