Placeholder image of a protein
Icon representing a puzzle

1318: Revisiting Puzzle 81: Calcium Ion Binding Protein

Closed since about 9 years ago

Intermediate Overall Prediction

Summary

Created
December 11, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, which inhibits muscle contraction in the absence of calcium ions, changes conformation in the presence of calcium to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


QAEARAFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 9,490
  2. Avatar for Beta Folders 2. Beta Folders 77 pts. 9,471
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 58 pts. 9,453
  4. Avatar for Contenders 4. Contenders 43 pts. 9,439
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 31 pts. 9,403
  6. Avatar for Void Crushers 6. Void Crushers 22 pts. 9,384
  7. Avatar for Deleted group 7. Deleted group pts. 9,360
  8. Avatar for Gargleblasters 8. Gargleblasters 11 pts. 9,312
  9. Avatar for HMT heritage 9. HMT heritage 7 pts. 9,192
  10. Avatar for :) 10. :) 5 pts. 9,120
  1. Avatar for gcm24 91. gcm24 Lv 1 6 pts. 9,062
  2. Avatar for navn 92. navn Lv 1 6 pts. 9,058
  3. Avatar for Darkly Deadpan 93. Darkly Deadpan Lv 1 6 pts. 9,055
  4. Avatar for jamiexq 94. jamiexq Lv 1 6 pts. 9,053
  5. Avatar for ComputerMage 95. ComputerMage Lv 1 6 pts. 9,049
  6. Avatar for Merf 96. Merf Lv 1 5 pts. 9,047
  7. Avatar for guineapig 97. guineapig Lv 1 5 pts. 9,042
  8. Avatar for katling 98. katling Lv 1 5 pts. 9,041
  9. Avatar for JUMELLE54 99. JUMELLE54 Lv 1 5 pts. 9,035
  10. Avatar for JayD7217 100. JayD7217 Lv 1 5 pts. 9,030

Comments