Placeholder image of a protein
Icon representing a puzzle

1318: Revisiting Puzzle 81: Calcium Ion Binding Protein

Closed since about 9 years ago

Intermediate Overall Prediction

Summary

Created
December 11, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, which inhibits muscle contraction in the absence of calcium ions, changes conformation in the presence of calcium to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


QAEARAFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for xkcd 11. xkcd 3 pts. 9,114
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 2 pts. 9,088
  3. Avatar for Russian team 13. Russian team 1 pt. 9,049
  4. Avatar for freefolder 14. freefolder 1 pt. 9,028
  5. Avatar for Kotocycle 15. Kotocycle 1 pt. 9,014
  6. Avatar for Freeport Honors Biology 16. Freeport Honors Biology 1 pt. 8,899
  7. Avatar for Deleted group 17. Deleted group pts. 8,732
  8. Avatar for R-MC Biochemistry 18. R-MC Biochemistry 1 pt. 8,449
  9. Avatar for Team South Africa 19. Team South Africa 1 pt. 8,293
  10. Avatar for DSN @ Home 20. DSN @ Home 1 pt. 8,060
  1. Avatar for parsnip 161. parsnip Lv 1 1 pt. 8,461
  2. Avatar for GPeakRMC 162. GPeakRMC Lv 1 1 pt. 8,449
  3. Avatar for Aricot 163. Aricot Lv 1 1 pt. 8,433
  4. Avatar for hc820080 164. hc820080 Lv 1 1 pt. 8,405
  5. Avatar for mindleaving 165. mindleaving Lv 1 1 pt. 8,404
  6. Avatar for rabetty 166. rabetty Lv 1 1 pt. 8,400
  7. Avatar for AlphaSniper 167. AlphaSniper Lv 1 1 pt. 8,396
  8. Avatar for Pietro MSB 168. Pietro MSB Lv 1 1 pt. 8,393
  9. Avatar for paulsomerville1963@outlook.com 169. paulsomerville1963@outlook.com Lv 1 1 pt. 8,391
  10. Avatar for NotJim99 170. NotJim99 Lv 1 1 pt. 8,383

Comments