Placeholder image of a protein
Icon representing a puzzle

1318: Revisiting Puzzle 81: Calcium Ion Binding Protein

Closed since over 9 years ago

Intermediate Overall Prediction

Summary

Created
December 11, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, which inhibits muscle contraction in the absence of calcium ions, changes conformation in the presence of calcium to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


QAEARAFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for xkcd 11. xkcd 3 pts. 9,114
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 2 pts. 9,088
  3. Avatar for Russian team 13. Russian team 1 pt. 9,049
  4. Avatar for freefolder 14. freefolder 1 pt. 9,028
  5. Avatar for Kotocycle 15. Kotocycle 1 pt. 9,014
  6. Avatar for Freeport Honors Biology 16. Freeport Honors Biology 1 pt. 8,899
  7. Avatar for Deleted group 17. Deleted group pts. 8,732
  8. Avatar for R-MC Biochemistry 18. R-MC Biochemistry 1 pt. 8,449
  9. Avatar for Team South Africa 19. Team South Africa 1 pt. 8,293
  10. Avatar for DSN @ Home 20. DSN @ Home 1 pt. 8,060
  1. Avatar for FishKAA 81. FishKAA Lv 1 9 pts. 9,091
  2. Avatar for monkry 82. monkry Lv 1 9 pts. 9,090
  3. Avatar for joaniegirl 83. joaniegirl Lv 1 9 pts. 9,089
  4. Avatar for Bushman 84. Bushman Lv 1 8 pts. 9,088
  5. Avatar for gurch 85. gurch Lv 1 8 pts. 9,081
  6. Avatar for WBarme1234 86. WBarme1234 Lv 1 8 pts. 9,080
  7. Avatar for mitarcher 87. mitarcher Lv 1 8 pts. 9,074
  8. Avatar for alcor29 88. alcor29 Lv 1 7 pts. 9,069
  9. Avatar for Deleted player 89. Deleted player pts. 9,064
  10. Avatar for stomjoh 90. stomjoh Lv 1 7 pts. 9,063

Comments